PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009589157.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family VOZ
Protein Properties Length: 475aa    MW: 52944.7 Da    PI: 6.1405
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009589157.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ418.79.6e-1291964151217
             VOZ   1 pppsaflgpkcalwdctrpaqgsewlq...dycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwna 92 
                     pppsaflgpkc+lwdc+rpa gs+w+q   dycs +ha+la neg pgt+pv+rp gi+lkd+llf+alsak+ gk+vgipecegaatakspw+a
  XP_009589157.1 196 PPPSAFLGPKCSLWDCPRPAMGSDWCQkshDYCSDYHASLAPNEGYPGTAPVVRPMGIGLKDNLLFQALSAKALGKDVGIPECEGAATAKSPWKA 290
                     89***********************976668**************************************************************** PP

             VOZ  93 aelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlel 187
                     +elfdl+++egetirewlffdkprrafesgnrkqrslpdy+grgwhesrkqvm+e+gglkrsyymdpqp++ +ewhlyeyein++d +alyrlel
  XP_009589157.1 291 PELFDLKVVEGETIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVMNEYGGLKRSYYMDPQPMKDLEWHLYEYEINKYDVCALYRLEL 385
                     *********************************************************************************************** PP

             VOZ 188 klvdekksakgkvskdsladlqkklgrlta 217
                     klvd+kks+kgkv+k+s+adlqk++grlta
  XP_009589157.1 386 KLVDGKKSPKGKVTKESVADLQKQMGRLTA 415
                     ****************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MWKGSKSGAG KSASHQLFKD KAKNRVDDLQ GVFTNLQSAR KESRTYDVGV LEEQVHQMLR  60
EWKAELNEPS PASSLQGGSR VSSDIYRLLL GEEEDDATSA LAAPKPEPVA PKNDVAGFQE  120
GFNVTPVLQE QGYQLVDQCK SMPLVVNNAG INNLGIATQQ DYNSFDLQQD FDRYFPGFDA  180
LNLCLEDVLP PVHISPPPSA FLGPKCSLWD CPRPAMGSDW CQKSHDYCSD YHASLAPNEG  240
YPGTAPVVRP MGIGLKDNLL FQALSAKALG KDVGIPECEG AATAKSPWKA PELFDLKVVE  300
GETIREWLFF DKPRRAFESG NRKQRSLPDY NGRGWHESRK QVMNEYGGLK RSYYMDPQPM  360
KDLEWHLYEY EINKYDVCAL YRLELKLVDG KKSPKGKVTK ESVADLQKQM GRLTAEFPSE  420
NKRSVKGRAK ANKDVAVNMH AVPNRIVPAS EGFDYGTGAP FPEYLVDNLG GYYVT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589156.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_009589157.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLM1D4F40.0M1D4F4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000812410.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein